Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM220A Rabbit Polyclonal Antibody (HRP)

FAM220A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SIPAR, ACPIN1, C7orf70

UniProt

Q7Z4H9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human FAM220A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ATPSTAVGLFPAPTECFARVSCSGVEALGRRDWLGGGPRATDGHRGQCPK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001032240

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-KDM6B/JMJD3 Picoband® Antibody (Biotine Conjugate)
A01309-1-Biotin 100 µg/Vial

Anti-KDM6B/JMJD3 Picoband® Antibody (Biotine Conjugate)

Sign In for Pricing
View Details
Zscan4f Protein Vector (Mouse) (pPB-C-His)
PV251146 500 ng

Zscan4f Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
FTL Recombinant Protein (Human)
RP012598 100 µg

FTL Recombinant Protein (Human)

Sign In for Pricing
View Details
CBFA2T2 (Core-Binding Factor, Runt Domain, alpha Subunit 2; Translocated to, 2, DKFZp313F2116, EHT, MTGR1, ZMYND3) (MaxLight 490)
MBS6205473-01 0.1 mL

CBFA2T2 (Core-Binding Factor, Runt Domain, alpha Subunit 2; Translocated to, 2, DKFZp313F2116, EHT, MTGR1, ZMYND3) (MaxLight 490)

Sign In for Pricing
View Details
CBFA2T2 (Core-Binding Factor, Runt Domain, alpha Subunit 2; Translocated to, 2, DKFZp313F2116, EHT, MTGR1, ZMYND3) (MaxLight 490)
MBS6205473-02 5x 0.1 mL

CBFA2T2 (Core-Binding Factor, Runt Domain, alpha Subunit 2; Translocated to, 2, DKFZp313F2116, EHT, MTGR1, ZMYND3) (MaxLight 490)

Sign In for Pricing
View Details
1-Aminopyrrolidin-2-one Hydrochloride
sc-481018 1 g

1-Aminopyrrolidin-2-one Hydrochloride

Sign In for Pricing
View Details