Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP89 Rabbit Polyclonal Antibody (HRP)

CEP89 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CEP123, CCDC123

UniProt

Q96ST8

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CEP89

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DRGGHSDDLYAVPHRNQVPLLHEVNSEDDENISHQDGFPGSPPAPQRTQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNA4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV647510 1.0 µg DNA

IFNA4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Anti-MitoNEET Rabbit pAb
GB111537-50 50 μL

Anti-MitoNEET Rabbit pAb

Sign In for Pricing
View Details
METHYL GREEN dye content For Microscopical Staining
113890 10 10 g

METHYL GREEN dye content For Microscopical Staining

Sign In for Pricing
View Details
GLI1 Antibody
orb1331324 100 µg

GLI1 Antibody

Sign In for Pricing
View Details
Mouse CD80 Rat Monoclonal Antibody
orb1172677 100 µg

Mouse CD80 Rat Monoclonal Antibody

Sign In for Pricing
View Details
Tau (phospho S202+T205) Recombinant Mouse mAb (AT8)
S0B0687-01 1 mL

Tau (phospho S202+T205) Recombinant Mouse mAb (AT8)

Sign In for Pricing
View Details