Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM222A Rabbit Polyclonal Antibody (HRP)

FAM222A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C12orf34

UniProt

Q5U5X8

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM222A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SRTVNGYDTSGQRYSPYPQHTAGYQGLLAIVKAAVSSSSTAAPAGPAKSV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_116218

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Cysteine And Tyrosine Rich Protein 1 (CYYR1) ELISA Kit
MBS7260738-01 48 Well

Porcine Cysteine And Tyrosine Rich Protein 1 (CYYR1) ELISA Kit

Sign In for Pricing
View Details
Porcine Cysteine And Tyrosine Rich Protein 1 (CYYR1) ELISA Kit
MBS7260738-02 96 Well

Porcine Cysteine And Tyrosine Rich Protein 1 (CYYR1) ELISA Kit

Sign In for Pricing
View Details
Porcine Cysteine And Tyrosine Rich Protein 1 (CYYR1) ELISA Kit
MBS7260738-03 5x 96 Well

Porcine Cysteine And Tyrosine Rich Protein 1 (CYYR1) ELISA Kit

Sign In for Pricing
View Details
Porcine Cysteine And Tyrosine Rich Protein 1 (CYYR1) ELISA Kit
MBS7260738-04 10x 96 Well

Porcine Cysteine And Tyrosine Rich Protein 1 (CYYR1) ELISA Kit

Sign In for Pricing
View Details
C4orf37 CRISPR Knock Out 293T Cell Line (Human)
14540141 1x 10^6 Cells / 1.0 mL

C4orf37 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
GLRA1 (Glycine Receptor, alpha 1, MGC138878, MGC138879, STHE) (APC)
246640-APC 100 µL

GLRA1 (Glycine Receptor, alpha 1, MGC138878, MGC138879, STHE) (APC)

Sign In for Pricing
View Details