Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEDAG Rabbit Polyclonal Antibody (HRP)

MEDAG Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AWMS3, MEDA4, MEDA-4, hAWMS3, C13orf33

UniProt

Q5VYS4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MEDAG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MLFFINVQTKKDTSKERTYAFLVNTRHPKIRRQIEQGMDMVISSVIGESY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_116238

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4EBP1 pThr45 Rabbit Polyclonal Antibody
AP02482PU-N 100 µL

EIF4EBP1 pThr45 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD41 Recombinant Rabbit Monoclonal Antibody [PSH08-03]
HA722940 100 µL

CD41 Recombinant Rabbit Monoclonal Antibody [PSH08-03]

Sign In for Pricing
View Details
Cetalkonium Chloride-d7
TRC-C280502-10MG 10 mg

Cetalkonium Chloride-d7

Sign In for Pricing
View Details
Mouse Agtr1b activation kit by CRISPRa
GA200127 1 Kit

Mouse Agtr1b activation kit by CRISPRa

Sign In for Pricing
View Details
Glutathione S Transferase theta 1 (GSTT1) (NM_001293814) Human Tagged ORF Clone
RG235459 10 µg

Glutathione S Transferase theta 1 (GSTT1) (NM_001293814) Human Tagged ORF Clone

Sign In for Pricing
View Details
HEXB Recombinant Rabbit monoclonal Antibody
HA751106 100 µL

HEXB Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details