Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tigd5 Rabbit Polyclonal Antibody (HRP)

Tigd5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AA409802, AA409995, AI666797

UniProt

Q499M4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Tigd5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGSTARPPPPPAPGPRPRVAVKMTFRKAYSIKDKLQAIERVKGGERQASV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_848761

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT12 Mouse Monoclonal Antibody [Clone ID: OTI1B7]
CF805506 100 µg

NUDT12 Mouse Monoclonal Antibody [Clone ID: OTI1B7]

Sign In for Pricing
View Details
Human KRTAP4-6 activation kit by CRISPRa
GA113142 1 Kit

Human KRTAP4-6 activation kit by CRISPRa

Sign In for Pricing
View Details
CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2670), Biotin conjugate, 0.1mg/mL
BNCB2670-500 1x 500 µL

CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2670), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Cytochrome b5 B/CYB5B Protein (His Tag)
PKSH032333-01 10 µg

Recombinant Human Cytochrome b5 B/CYB5B Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Cytochrome b5 B/CYB5B Protein (His Tag)
PKSH032333-02 50 µg

Recombinant Human Cytochrome b5 B/CYB5B Protein (His Tag)

Sign In for Pricing
View Details
Rat Complement Receptor 2 (CR2) ELISA Kit
RDR-CR2-Ra-01 96 Tests

Rat Complement Receptor 2 (CR2) ELISA Kit

Sign In for Pricing
View Details