Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP11B Rabbit Polyclonal Antibody (HRP)

ARHGAP11B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B'-T, FAM7B1, GAP (1-8)

UniProt

Q3KRB8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ARHGAP11B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDSSNLAVIFAPNLLQTSEGHEKMSSNAEKKGVYQTLSWKRYQPCWVLMV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001034930

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAG (NM_002361) Human Tagged ORF Clone Lentiviral Particle
RC208754L3V 200 µL

MAG (NM_002361) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Terminal Nucleotidyltransferase 4A (TENT4A) Antibody
abx135935-01 20 µL

Terminal Nucleotidyltransferase 4A (TENT4A) Antibody

Sign In for Pricing
View Details
Terminal Nucleotidyltransferase 4A (TENT4A) Antibody
abx135935-02 100 µL

Terminal Nucleotidyltransferase 4A (TENT4A) Antibody

Sign In for Pricing
View Details
Terminal Nucleotidyltransferase 4A (TENT4A) Antibody
abx135935-03 2x 100 µL

Terminal Nucleotidyltransferase 4A (TENT4A) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Lysozyme Antibody (LYZ/3944) [HRP]
NBP3-14115H 0.1 mL

Mouse Monoclonal Lysozyme Antibody (LYZ/3944) [HRP]

Sign In for Pricing
View Details
Parathyroid Hormone Related Protein (PTHrP, PTHLH, HHM, PTHR, PLP, Osteostatin, Parathyroid Hormone Like Hormone)
141776 200 µL

Parathyroid Hormone Related Protein (PTHrP, PTHLH, HHM, PTHR, PLP, Osteostatin, Parathyroid Hormone Like Hormone)

Sign In for Pricing
View Details