Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC120 Rabbit Polyclonal Antibody (HRP)

CCDC120 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

JM11

UniProt

Q96HB5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC120

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGSQDSQMGFPRADPASDRASLFVARTRRSNSSEALLVDRAAGGGAGSPP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_296375

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine CCR4-NOT transcription complex subunit 8 (CNOT8) ELISA Kit
MBS7243895-01 48 Well

Bovine CCR4-NOT transcription complex subunit 8 (CNOT8) ELISA Kit

Sign In for Pricing
View Details
Bovine CCR4-NOT transcription complex subunit 8 (CNOT8) ELISA Kit
MBS7243895-02 96 Well

Bovine CCR4-NOT transcription complex subunit 8 (CNOT8) ELISA Kit

Sign In for Pricing
View Details
Bovine CCR4-NOT transcription complex subunit 8 (CNOT8) ELISA Kit
MBS7243895-03 5x 96 Well

Bovine CCR4-NOT transcription complex subunit 8 (CNOT8) ELISA Kit

Sign In for Pricing
View Details
Bovine CCR4-NOT transcription complex subunit 8 (CNOT8) ELISA Kit
MBS7243895-04 10x 96 Well

Bovine CCR4-NOT transcription complex subunit 8 (CNOT8) ELISA Kit

Sign In for Pricing
View Details
Bovine Eb Virus IgD ELISA Kit
BG-BVN10836 1 Each

Bovine Eb Virus IgD ELISA Kit

Sign In for Pricing
View Details
GPR31 Blocking Peptide
MBS9622969-01 1 mg

GPR31 Blocking Peptide

Sign In for Pricing
View Details