Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C15orf23 Rabbit Polyclonal Antibody (FITC)

C15orf23 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SKAP, HSD11, C15orf23, TRAF4AF1

UniProt

Q9Y448

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human C15orf23

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TDTATRRNVRKGYKPLSKQKSEEELKDKNQLLEAVNKQLHQKLTETQGEL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_150628

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atg10 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6746204 1.0 µg DNA

Atg10 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
OAT-3 Polyclonal Antibody, RBITC Conjugated
bs-42422R-RBITC 100 µL

OAT-3 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
CD26 (Dipeptidyl Peptidase 4) BioAssayTM ELISA Kit (Human) discontinued
354608-01 48 Tests

CD26 (Dipeptidyl Peptidase 4) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
CD26 (Dipeptidyl Peptidase 4) BioAssayTM ELISA Kit (Human) discontinued
354608-02 96 Tests

CD26 (Dipeptidyl Peptidase 4) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
PMSA (FOLH1) - CHO Recombinant Cell Line (Medium Expression)
79641-M 2 vials

PMSA (FOLH1) - CHO Recombinant Cell Line (Medium Expression)

Sign In for Pricing
View Details
TRLP1 sgRNA CRISPR Lentivector set (Human)
K2471001 3x 1.0 µg

TRLP1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details