Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STPG1 Rabbit Polyclonal Antibody (Biotin)

STPG1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MAPO2, C1orf201

UniProt

Q5TH74

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human STPG1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SCFKSKTNRGLKLTSTGPGPGYYNPSDCTKVPKKTLFPKNPILNFSAQPS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_835223

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adal sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4769108 1.0 µg DNA

Adal sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Texas Red Conjugated Affinity Purified Anti-MOUSE IgM (mu chain) (GOAT)
GWB-FE8F97 2 mg

Texas Red Conjugated Affinity Purified Anti-MOUSE IgM (mu chain) (GOAT)

Sign In for Pricing
View Details
Recombinant Human C4a Protein, N-His
orb3062536-01 50 µg

Recombinant Human C4a Protein, N-His

Sign In for Pricing
View Details
Recombinant Human C4a Protein, N-His
orb3062536-02 100 µg

Recombinant Human C4a Protein, N-His

Sign In for Pricing
View Details
Recombinant Human C4a Protein, N-His
orb3062536-03 1 mg

Recombinant Human C4a Protein, N-His

Sign In for Pricing
View Details
ADH7, CT (ADH7, Alcohol dehydrogenase class 4 mu/sigma chain, Alcohol dehydrogenase class IV mu/sigma chain, Gastric alcohol dehydrogenase, Retinol dehydrogenase) (FITC) discontinued
031640-FITC 200 µL

ADH7, CT (ADH7, Alcohol dehydrogenase class 4 mu/sigma chain, Alcohol dehydrogenase class IV mu/sigma chain, Gastric alcohol dehydrogenase, Retinol dehydrogenase) (FITC) discontinued

Sign In for Pricing
View Details