Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMM29 Rabbit Polyclonal Antibody (HRP)

TIMM29 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TIM29, C19orf52

UniProt

Q9BSF4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C19orf52

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PQQLHSETNERLFDEKYKPVVLTDDQVDQALWEEQVLQKEKKDRLALSQA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_612367

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human AGO3 (NM_177422) AAV Particle
RC211382A1V 250 µL

Human AGO3 (NM_177422) AAV Particle

Sign In for Pricing
View Details
Heyl (NM_013905) Mouse Tagged ORF Clone
MR221867 10 µg

Heyl (NM_013905) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Ppp1r16b qPCR Primer Pair
QM58710S 200 Tests

Mouse Ppp1r16b qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant Anti-Carboxypeptidase A2 Antibody, Rabbit Monoclonal
MBS8112061-01 0.1 mL

Recombinant Anti-Carboxypeptidase A2 Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details
Recombinant Anti-Carboxypeptidase A2 Antibody, Rabbit Monoclonal
MBS8112061-02 5x 0.1 mL

Recombinant Anti-Carboxypeptidase A2 Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details
OKAG00425-96W - NR2F6 DNA-Binding ELISA Kit
OKAG00425-96W 12x 8 Well Microstrips

OKAG00425-96W - NR2F6 DNA-Binding ELISA Kit

Sign In for Pricing
View Details