Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGEL2 Rabbit Polyclonal Antibody (FITC)

ANGEL2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ccr4d, KIAA0759L

UniProt

Q96AL9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ANGEL2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SRTQFQYCNWRPDNLSQTSLIHLSSYVMNAEGDEPSSKRRKHQGVIKRNW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GEN1 Human Gene Knockout Kit (CRISPR)
KN421451 1 Kit

GEN1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GPCR LGR6 Recombinant Rabbit Monoclonal Antibody [JE39-78]
HA721370 100 µL

GPCR LGR6 Recombinant Rabbit Monoclonal Antibody [JE39-78]

Sign In for Pricing
View Details
Tissue FFPE Sections, Myometrium
CS800349 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
Uncoated Porcine TFPI (Tissue Factor Pathway Inhibitor) ELISA Kit
E-UNEL-P0022-01 5x 96 Tests

Uncoated Porcine TFPI (Tissue Factor Pathway Inhibitor) ELISA Kit

Sign In for Pricing
View Details
Uncoated Porcine TFPI (Tissue Factor Pathway Inhibitor) ELISA Kit
E-UNEL-P0022-02 15x 96 Tests

Uncoated Porcine TFPI (Tissue Factor Pathway Inhibitor) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human coronavirus (HCoV-HKU1) Nucleoprotein / NP Protein (His Tag)
PKSV030201 100 µg

Recombinant Human coronavirus (HCoV-HKU1) Nucleoprotein / NP Protein (His Tag)

Sign In for Pricing
View Details