Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMAC1 Rabbit Polyclonal Antibody (FITC)

DMAC1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TMEM261, C9orf123

UniProt

Q96GE9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C9orf123

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MGAGGYVYWVARKPMKMGYPPSPWTITQMVIGLSIATWGIVVMADPKGKA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_219500

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human STK4 shRNA (UAS) - Lentiviral human STK4 shRNA (UAS, GFP) (25)
GTR15315635 1 Vial

Lentiviral human STK4 shRNA (UAS) - Lentiviral human STK4 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
WFS1 (NM_001145853) Human Recombinant Protein
TP327925L 1 mg

WFS1 (NM_001145853) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Plasmodium Chabaudi OAT Protein (aa 1-414) (Yeast)
VAng-Wyb7730-inquire Inquire

Recombinant Plasmodium Chabaudi OAT Protein (aa 1-414) (Yeast)

Sign In for Pricing
View Details
Calcitonin receptor Rabbit Polyclonal Antibody (BF680)
orb2559749 100 µL

Calcitonin receptor Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
CSRP1 (Cysteine And Glycine-rich Protein 1, Cysteine-rich Protein 1, CRP1, CRP, CSRP, CYRP) (APC)
C9001-09B-APC 100 µL

CSRP1 (Cysteine And Glycine-rich Protein 1, Cysteine-rich Protein 1, CRP1, CRP, CSRP, CYRP) (APC)

Sign In for Pricing
View Details
Rabbit Polyclonal MCM3AP Antibody [DyLight 350]
NBP1-71882UV 0.1 mL

Rabbit Polyclonal MCM3AP Antibody [DyLight 350]

Sign In for Pricing
View Details