Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC149 Rabbit Polyclonal Antibody (Biotin)

CCDC149 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q6ZUS6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC149

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LLKFVEQPTENKADPKDGEAQKQEEDESCAAAEALTAPEDAGRPAVNSPA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_775734

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey BACE1 ELISA Kit
EMKB0322 96 Tests

Monkey BACE1 ELISA Kit

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Alanine--tRNA ligase (alaS), partial
MBS1187566 Inquire

Recombinant Staphylococcus aureus Alanine--tRNA ligase (alaS), partial

Sign In for Pricing
View Details
CYCSP23 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV759594 1.0 µg DNA

CYCSP23 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Major Histocompatibility Complex Class I G (MHCG, HLA-G, MHC-G; HLAG, Leukocyte Antigen G, b2 microglobulin)
141366 200 µL

Major Histocompatibility Complex Class I G (MHCG, HLA-G, MHC-G; HLAG, Leukocyte Antigen G, b2 microglobulin)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Fucosidase Alpha L1, Tissue (FUCa1)
MBS2047781-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Fucosidase Alpha L1, Tissue (FUCa1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Fucosidase Alpha L1, Tissue (FUCa1)
MBS2047781-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Fucosidase Alpha L1, Tissue (FUCa1)

Sign In for Pricing
View Details