Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC34 Rabbit Polyclonal Antibody (Biotin)

CCDC34 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L15, RAMA3, NY-REN-41

UniProt

Q96HJ3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC34

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IGKEKEERDRLQLKALEELNQQLEKRKEMEEREKRKIIAEEKHKEWVQKK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_542385

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CRISPR-Cas9 Antibody (6G12) [Alexa Fluor 532]
NBP2-52398AF532 0.1 mL

Mouse Monoclonal CRISPR-Cas9 Antibody (6G12) [Alexa Fluor 532]

Sign In for Pricing
View Details
SNX11 (Sorting Nexin-11) (PE)
MBS6394673-01 0.1 mL

SNX11 (Sorting Nexin-11) (PE)

Sign In for Pricing
View Details
SNX11 (Sorting Nexin-11) (PE)
MBS6394673-02 5x 0.1 mL

SNX11 (Sorting Nexin-11) (PE)

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Receptor Superfamily, Member 17 (TNFRSF17) ELISA Kit
orb1663137-01 48 Tests

Mouse Tumor Necrosis Factor Receptor Superfamily, Member 17 (TNFRSF17) ELISA Kit

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Receptor Superfamily, Member 17 (TNFRSF17) ELISA Kit
orb1663137-02 96 Tests

Mouse Tumor Necrosis Factor Receptor Superfamily, Member 17 (TNFRSF17) ELISA Kit

Sign In for Pricing
View Details
CA7 (NM_005182) Human Tagged Lenti ORF Clone
RC215024L4 10 µg

CA7 (NM_005182) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details