Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

R3hdm4 Rabbit Polyclonal Antibody (HRP)

R3hdm4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI503502, C030046I01Rik

UniProt

Q4VBF2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse R3hdm4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MVALDNSEGGPEATPSGETRLSLPGCLPPLSGSQVKRVSASRRKQHFINQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_818775

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-27, ID (Interleukin-17D, IL-17D, Interleukin-27, IL17D, IL27, UNQ3096/PRO21175) (AP)
MBS6483358-01 0.2 mL

IL-27, ID (Interleukin-17D, IL-17D, Interleukin-27, IL17D, IL27, UNQ3096/PRO21175) (AP)

Sign In for Pricing
View Details
IL-27, ID (Interleukin-17D, IL-17D, Interleukin-27, IL17D, IL27, UNQ3096/PRO21175) (AP)
MBS6483358-02 5x 0.2 mL

IL-27, ID (Interleukin-17D, IL-17D, Interleukin-27, IL17D, IL27, UNQ3096/PRO21175) (AP)

Sign In for Pricing
View Details
APOBEC3G, CT (DNA dC->dU-editing Enzyme APOBEC-3G, APOBEC-related Cytidine Deaminase, ARCD, APOBEC-related Protein, ARP-9, APOBEC-related Protein 9, CEM15, CEM-15, MDS019) (Biotin)
MBS6463535-01 0.2 mL

APOBEC3G, CT (DNA dC->dU-editing Enzyme APOBEC-3G, APOBEC-related Cytidine Deaminase, ARCD, APOBEC-related Protein, ARP-9, APOBEC-related Protein 9, CEM15, CEM-15, MDS019) (Biotin)

Sign In for Pricing
View Details
APOBEC3G, CT (DNA dC->dU-editing Enzyme APOBEC-3G, APOBEC-related Cytidine Deaminase, ARCD, APOBEC-related Protein, ARP-9, APOBEC-related Protein 9, CEM15, CEM-15, MDS019) (Biotin)
MBS6463535-02 5x 0.2 mL

APOBEC3G, CT (DNA dC->dU-editing Enzyme APOBEC-3G, APOBEC-related Cytidine Deaminase, ARCD, APOBEC-related Protein, ARP-9, APOBEC-related Protein 9, CEM15, CEM-15, MDS019) (Biotin)

Sign In for Pricing
View Details
Rat ATP binding cassette sub family B member 9 (ABCB9) ELISA Kit
GTR10349667 96 Well

Rat ATP binding cassette sub family B member 9 (ABCB9) ELISA Kit

Sign In for Pricing
View Details
PD-L1 inhibitory peptide TFA
TP3811-01 10 mg

PD-L1 inhibitory peptide TFA

Sign In for Pricing
View Details