Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD40 Rabbit Polyclonal Antibody (Biotin)

ANKRD40 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q6AI12

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ANKRD40

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AILRTPESTKPGPVCQPPVSQSRSLFSSVPSKPPMSLEPQNGTYAGPAPA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_443087

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM108, CT (TMEM108, KIAA1690, Transmembrane protein 108) (PE) discontinued
042936-PE 200 µL

TMEM108, CT (TMEM108, KIAA1690, Transmembrane protein 108) (PE) discontinued

Sign In for Pricing
View Details
ENTPD2, NT (ENTPD2, CD39L1, Ectonucleoside triphosphate diphosphohydrolase 2, CD39 antigen-like 1, Ecto-ATP diphosphohydrolase 2) (MaxLight 650)
MBS6295762-01 0.1 mL

ENTPD2, NT (ENTPD2, CD39L1, Ectonucleoside triphosphate diphosphohydrolase 2, CD39 antigen-like 1, Ecto-ATP diphosphohydrolase 2) (MaxLight 650)

Sign In for Pricing
View Details
ENTPD2, NT (ENTPD2, CD39L1, Ectonucleoside triphosphate diphosphohydrolase 2, CD39 antigen-like 1, Ecto-ATP diphosphohydrolase 2) (MaxLight 650)
MBS6295762-02 5x 0.1 mL

ENTPD2, NT (ENTPD2, CD39L1, Ectonucleoside triphosphate diphosphohydrolase 2, CD39 antigen-like 1, Ecto-ATP diphosphohydrolase 2) (MaxLight 650)

Sign In for Pricing
View Details
Polypropylene Wide Mouth Bottle and cap 250ml
BOT2226 12 / PCK

Polypropylene Wide Mouth Bottle and cap 250ml

Sign In for Pricing
View Details
Rabbit anti-human nucleolar and coiled-body phosphoprotein 1 polyclonal Antibody
MBS713520-01 0.1 mL

Rabbit anti-human nucleolar and coiled-body phosphoprotein 1 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human nucleolar and coiled-body phosphoprotein 1 polyclonal Antibody
MBS713520-02 5x 0.1 mL

Rabbit anti-human nucleolar and coiled-body phosphoprotein 1 polyclonal Antibody

Sign In for Pricing
View Details