Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tpgs1 Rabbit Polyclonal Antibody (FITC)

Tpgs1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PGs1, Gtrgeo, Gm16517, AV005629, Gtrgeo22

UniProt

Q99MS8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Tpgs1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DGRTYSELLKRVCRDGGAPEEVVAPLLRKIQCRDHEAVPLGIFRTGMLSC

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_683736

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Herpes simplex virus 2, HSV-Ag2 ELISA Kit
NB-E10756-01 96 Well

Human Herpes simplex virus 2, HSV-Ag2 ELISA Kit

Sign In for Pricing
View Details
Human Herpes simplex virus 2, HSV-Ag2 ELISA Kit
NB-E10756-02 96 Well

Human Herpes simplex virus 2, HSV-Ag2 ELISA Kit

Sign In for Pricing
View Details
VEGF-R1 (Fms like tyrosine kinase 1 (Flt-1), Fms-like tyrosine kinase 1, FRT, Tyrosine protein kinase FRT, Tyrosine protein kinase receptor FLT, Vascular endothelial growth factor receptor 1 (VEGFR1), Vascular permeability factor receptor 1) (BSA & Azide Free)
168887-AF 100 µg

VEGF-R1 (Fms like tyrosine kinase 1 (Flt-1), Fms-like tyrosine kinase 1, FRT, Tyrosine protein kinase FRT, Tyrosine protein kinase receptor FLT, Vascular endothelial growth factor receptor 1 (VEGFR1), Vascular permeability factor receptor 1) (BSA & Azide Free)

Sign In for Pricing
View Details
Recombinant Human G3BP2
MBS7611669-01 0.05 mg

Recombinant Human G3BP2

Sign In for Pricing
View Details
Recombinant Human G3BP2
MBS7611669-02 0.2 mg

Recombinant Human G3BP2

Sign In for Pricing
View Details
Recombinant Human G3BP2
MBS7611669-03 1 mg

Recombinant Human G3BP2

Sign In for Pricing
View Details