Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tpgs1 Rabbit Polyclonal Antibody (HRP)

Tpgs1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PGs1, Gtrgeo, Gm16517, AV005629, Gtrgeo22

UniProt

Q99MS8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Tpgs1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DGRTYSELLKRVCRDGGAPEEVVAPLLRKIQCRDHEAVPLGIFRTGMLSC

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_683736

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Vascular Endothelial Growth Factor A (VEGFA) ELISA Kit
DLR-VEGFA-Mu-01 48 Tests

Mouse Vascular Endothelial Growth Factor A (VEGFA) ELISA Kit

Sign In for Pricing
View Details
Mouse Vascular Endothelial Growth Factor A (VEGFA) ELISA Kit
DLR-VEGFA-Mu-02 96 Tests

Mouse Vascular Endothelial Growth Factor A (VEGFA) ELISA Kit

Sign In for Pricing
View Details
Anti Triazine Pab Rat
150284 100 µg

Anti Triazine Pab Rat

Sign In for Pricing
View Details
Rabbit Polyclonal CCDC135 Antibody
NBP3-10716-100ul 100 µL

Rabbit Polyclonal CCDC135 Antibody

Sign In for Pricing
View Details
Fish Phosphatidylinositol 4-Kinase Beta (PI4KB) ELISA Kit
MBS9922175 Inquire

Fish Phosphatidylinositol 4-Kinase Beta (PI4KB) ELISA Kit

Sign In for Pricing
View Details
CD46 Antibody
E91653 100 µL

CD46 Antibody

Sign In for Pricing
View Details