Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf105 Rabbit Polyclonal Antibody (HRP)

C1orf105 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O95561

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C1orf105

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PEPFHDDIPTESIHYRLPILGPRTAVFHGLLTEAYKTLKERQRSSLPRKE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_640333

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIM1 (N-term) Rabbit Polyclonal Antibody
AP53918PU-N 400 µL

SIM1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EBF3 (Transcription Factor COE3, Early B Cell Factor 3, EBF-3, Olf-1/EBF-like 2, O/E-2, OE-2, COE3) (MaxLight 650)
MBS6220410-01 0.1 mL

EBF3 (Transcription Factor COE3, Early B Cell Factor 3, EBF-3, Olf-1/EBF-like 2, O/E-2, OE-2, COE3) (MaxLight 650)

Sign In for Pricing
View Details
EBF3 (Transcription Factor COE3, Early B Cell Factor 3, EBF-3, Olf-1/EBF-like 2, O/E-2, OE-2, COE3) (MaxLight 650)
MBS6220410-02 5x 0.1 mL

EBF3 (Transcription Factor COE3, Early B Cell Factor 3, EBF-3, Olf-1/EBF-like 2, O/E-2, OE-2, COE3) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit Monoclonal Calreticulin Antibody (SAIC-16D-6B9) [Janelia Fluor 646]
NBP3-20094JF646 0.1 mL

Rabbit Monoclonal Calreticulin Antibody (SAIC-16D-6B9) [Janelia Fluor 646]

Sign In for Pricing
View Details
TGFB1 Rabbit Polyclonal Antibody
orb1545350-01 50 μL

TGFB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TGFB1 Rabbit Polyclonal Antibody
orb1545350-02 100 µL

TGFB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details