Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf158 Rabbit Polyclonal Antibody (FITC)

C1orf158 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q8N1D5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C1orf158

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KVLTGNWMEERRKFTRDTDKTPQSIYRKEYIPFPDHRPDQISRWYGKRKV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689503

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAP2 Polyclonal Antibody
A58018-050 50 µL

ADAP2 Polyclonal Antibody

Sign In for Pricing
View Details
ZFAND2A CRISPRa sgRNA lentivector (set of three targets)(Rat)
50818126 3x 1.0µg DNA

ZFAND2A CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Lentiviral human FZD3 shRNA (UAS) - Lentiviral human FZD3 shRNA (UAS, RFP) (25)
GTR15332906 1 Vial

Lentiviral human FZD3 shRNA (UAS) - Lentiviral human FZD3 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Lentiviral human MLC1 sgRNA gene knockout kit - Lentiviral human MLC1 sgRNA gene knockout kit (25)
GTR15390384 1 Vial

Lentiviral human MLC1 sgRNA gene knockout kit - Lentiviral human MLC1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
AdmiRa-Off-mmu-miR-449c-3p Virus
mm6143 1.0 mL

AdmiRa-Off-mmu-miR-449c-3p Virus

Sign In for Pricing
View Details
Rabbit Anti-4E-BP1/4EBP1 Polyclonal Antibody
PAV4575 100 μL

Rabbit Anti-4E-BP1/4EBP1 Polyclonal Antibody

Sign In for Pricing
View Details