Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASC4 Rabbit Polyclonal Antibody (FITC)

CASC4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

H63, CASC4

UniProt

A8K4R1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CASC4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FQCGQQMKELRAQHEENIKKLADQFLEEQKQETQKIQSNDGKELDINNQV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse

Tested Applications

WB

NCBI Accession Number

NP_816929

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human NCAPH sgRNA gene knockout kit - Lentiviral human NCAPH sgRNA gene knockout kit (25)
GTR15391887 1 Vial

Lentiviral human NCAPH sgRNA gene knockout kit - Lentiviral human NCAPH sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
FCRL4 Rabbit pAb
A10329 1000 μL

FCRL4 Rabbit pAb

Sign In for Pricing
View Details
PPP1R10P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1704807 1.0 µg DNA

PPP1R10P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Human PGK1 Protein, N-His
AP90362 50 µg

Recombinant Human PGK1 Protein, N-His

Sign In for Pricing
View Details
Influenza A H5N1 (A/chicken/Jilin/9/2004) Hemagglutinin/HA Protein (His Tag)
MBS8118785-01 0.1 mg

Influenza A H5N1 (A/chicken/Jilin/9/2004) Hemagglutinin/HA Protein (His Tag)

Sign In for Pricing
View Details
Influenza A H5N1 (A/chicken/Jilin/9/2004) Hemagglutinin/HA Protein (His Tag)
MBS8118785-02 5x 0.1 mg

Influenza A H5N1 (A/chicken/Jilin/9/2004) Hemagglutinin/HA Protein (His Tag)

Sign In for Pricing
View Details