Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC124 Rabbit Polyclonal Antibody (Biotin)

CCDC124 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Lso2, oxs1

UniProt

Q96CT7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CCDC124

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VMRKEQRKEEKEKRRLDQLERKKETQRLLEEEDSKLKGGKAPRVATSSKV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_612451

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin A (Cyclin-A1, CCNA1, Cyclin A1, CyclinA1, Cyclin-A2, Cyclin-A, Cyclin A, CyclinA, CCNA2, CCN1, CCNA) discontinued
221964-01 50 µL

Cyclin A (Cyclin-A1, CCNA1, Cyclin A1, CyclinA1, Cyclin-A2, Cyclin-A, Cyclin A, CyclinA, CCNA2, CCN1, CCNA) discontinued

Sign In for Pricing
View Details
Cyclin A (Cyclin-A1, CCNA1, Cyclin A1, CyclinA1, Cyclin-A2, Cyclin-A, Cyclin A, CyclinA, CCNA2, CCN1, CCNA) discontinued
221964-02 100 µL

Cyclin A (Cyclin-A1, CCNA1, Cyclin A1, CyclinA1, Cyclin-A2, Cyclin-A, Cyclin A, CyclinA, CCNA2, CCN1, CCNA) discontinued

Sign In for Pricing
View Details
AAS Tungsten Std 10000ppm in H2O
AAW-M 500 mL

AAS Tungsten Std 10000ppm in H2O

Sign In for Pricing
View Details
Neomycin 30 µg
7064 5x 50 Discs

Neomycin 30 µg

Sign In for Pricing
View Details
CREB (Phospho-S129) Antibody
E38PA5379 100 µL

CREB (Phospho-S129) Antibody

Sign In for Pricing
View Details
TBX22 Antibody
OACA07452-50UL 50 µL

TBX22 Antibody

Sign In for Pricing
View Details