Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB42 Rabbit Polyclonal Antibody (Biotin)

RAB42 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RP4-669K10.6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB42

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AFDTLADAIQQALQQGDIKLEEGWGGVRLIHKTQIPRSPSRKQHSGPCQC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001180461

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CTGF/CCN2 Antibody (18E7) [Alexa Fluor 488]
NBP2-60235AF488 0.1 mL

Mouse Monoclonal CTGF/CCN2 Antibody (18E7) [Alexa Fluor 488]

Sign In for Pricing
View Details
Human PLXNB2 siRNA
abx929018-01 15 nmol

Human PLXNB2 siRNA

Sign In for Pricing
View Details
Human PLXNB2 siRNA
abx929018-02 30 nmol

Human PLXNB2 siRNA

Sign In for Pricing
View Details
Lix1l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4255206 1.0 µg DNA

Lix1l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant Human Golgin subfamily A member 8N (GOG8N), Biotinylated
orb3005503-01 20 µg

Recombinant Human Golgin subfamily A member 8N (GOG8N), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Golgin subfamily A member 8N (GOG8N), Biotinylated
orb3005503-02 100 µg

Recombinant Human Golgin subfamily A member 8N (GOG8N), Biotinylated

Sign In for Pricing
View Details