Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB42 Rabbit Polyclonal Antibody (FITC)

RAB42 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RP4-669K10.6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB42

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AFDTLADAIQQALQQGDIKLEEGWGGVRLIHKTQIPRSPSRKQHSGPCQC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001180461

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Selenium-binding protein 1, SELENBP1 ELISA KIT
E3250Hu-01 48 Well

Human Selenium-binding protein 1, SELENBP1 ELISA KIT

Sign In for Pricing
View Details
Human Selenium-binding protein 1, SELENBP1 ELISA KIT
E3250Hu-02 96 Well

Human Selenium-binding protein 1, SELENBP1 ELISA KIT

Sign In for Pricing
View Details
Human Selenium-binding protein 1, SELENBP1 ELISA KIT
E3250Hu-03 5x 96 Tests

Human Selenium-binding protein 1, SELENBP1 ELISA KIT

Sign In for Pricing
View Details
Human Selenium-binding protein 1, SELENBP1 ELISA KIT
E3250Hu-04 10x 96 Tests

Human Selenium-binding protein 1, SELENBP1 ELISA KIT

Sign In for Pricing
View Details
Mouse Monoclonal GFAP Antibody (rGFAP/8685) [PE]
NBP3-24332PE 0.1 mL

Mouse Monoclonal GFAP Antibody (rGFAP/8685) [PE]

Sign In for Pricing
View Details
Mouse Ppp4r4 Pre-designed siRNA Set B
SI111067B 1 Each

Mouse Ppp4r4 Pre-designed siRNA Set B

Sign In for Pricing
View Details