Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GINM1 Rabbit Polyclonal Antibody (HRP)

GINM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C6orf72

UniProt

Q9NU53

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human GINM1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SVRILVHEWPMTSGSSLQLIVIQEEVVEIDGKQVQQKDVTEIDILVKNRG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_620140

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THRB Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
46670064 1.0 µg DNA

THRB Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
MST4 (Mammalian STE20-like Protein Kinase 4, MST-4, Serine/threonine-protein Kinase MST4, STE20-like Kinase MST4, Mst3 and SOK1-related Kinase, MASK, Serine/threonine-protein Kinase MASK, RP6-213H19.1) (APC)
132748-APC 100 µL

MST4 (Mammalian STE20-like Protein Kinase 4, MST-4, Serine/threonine-protein Kinase MST4, STE20-like Kinase MST4, Mst3 and SOK1-related Kinase, MASK, Serine/threonine-protein Kinase MASK, RP6-213H19.1) (APC)

Sign In for Pricing
View Details
SARS-CoV-2 S-RBD & E Protein & M Protein Rabbit Polyclonal Antibody
orb2953070-01 50 µg

SARS-CoV-2 S-RBD & E Protein & M Protein Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SARS-CoV-2 S-RBD & E Protein & M Protein Rabbit Polyclonal Antibody
orb2953070-02 100 µg

SARS-CoV-2 S-RBD & E Protein & M Protein Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chicken 1,3-bD glucosidase ELISA Kit
ELA-67004c 96 Tests

Chicken 1,3-bD glucosidase ELISA Kit

Sign In for Pricing
View Details
Dcpp2 (NM_001039238) Mouse Tagged Lenti ORF Clone
MR212937L3 10 µg

Dcpp2 (NM_001039238) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details