Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD22 Rabbit Polyclonal Antibody (Biotin)

ANKRD22 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q5VYY1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ANKRD22

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CRRGHVRIVSFLLRRNANVNLKNQKERTCLHYAVKKKFTFIDYLLIILLM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_653191

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti Human CD40 Flow Cytometry Monoclonal Clone G285 AF647 Ready To Use 200 Tests
IMSAHUCD40G285CAF647200 200 Tests

Anti Human CD40 Flow Cytometry Monoclonal Clone G285 AF647 Ready To Use 200 Tests

Sign In for Pricing
View Details
Fibroblast Growth Factor 7 (FGF7) Porcine ELISA Kit
D4055 96 Tests

Fibroblast Growth Factor 7 (FGF7) Porcine ELISA Kit

Sign In for Pricing
View Details
METTL3 CRISPR Knock Out Caki-1 Cell Line - Clone T2-16
T9623 1x106 cells / 1.0 mL

METTL3 CRISPR Knock Out Caki-1 Cell Line - Clone T2-16

Sign In for Pricing
View Details
Dab1 siRNA Oligos set (Rat)
17633176 3x 5 nmol

Dab1 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
EML1 AAV Vector (Human) (CMV)
19260102 1 µg

EML1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Recombinant Human IL11 / Interleukin-11, Animal Free & Carrier Free
C-CYP136-1mg 1 mg

Recombinant Human IL11 / Interleukin-11, Animal Free & Carrier Free

Sign In for Pricing
View Details