Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM52B Rabbit Polyclonal Antibody (HRP)

TMEM52B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C12orf59

UniProt

Q4KMG9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMEM52B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LGQLPSSLDTLPGYEEALHMSRFTVAMCGQKAPDLPPVPEEKQLPPTEKE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_694567

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ganglioside GD3, O-acetyl (MaxLight 750) discontinued
G2005-50A-ML750 100 µL

Ganglioside GD3, O-acetyl (MaxLight 750) discontinued

Sign In for Pricing
View Details
RAGE (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, AGER) (PE)
MBS6401911-01 0.1 mL

RAGE (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, AGER) (PE)

Sign In for Pricing
View Details
RAGE (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, AGER) (PE)
MBS6401911-02 5x 0.1 mL

RAGE (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, AGER) (PE)

Sign In for Pricing
View Details
Porcine CXC-chemokine receptor 2 ELISA Kit
MBS749825-01 48 Well

Porcine CXC-chemokine receptor 2 ELISA Kit

Sign In for Pricing
View Details
Porcine CXC-chemokine receptor 2 ELISA Kit
MBS749825-02 96 Well

Porcine CXC-chemokine receptor 2 ELISA Kit

Sign In for Pricing
View Details
Porcine CXC-chemokine receptor 2 ELISA Kit
MBS749825-03 5x 96 Well

Porcine CXC-chemokine receptor 2 ELISA Kit

Sign In for Pricing
View Details