Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC159 Rabbit Polyclonal Antibody (HRP)

CCDC159 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P0C7I6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC159

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CRKILTKMKQQGHETAACPETEEIPQGASGCWKDDLQKELSDIWSAVHVL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001073972

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Serotonin N-acetyltransferase (AANAT) ELISA Kit
MBS7238482-01 48 Well

Chicken Serotonin N-acetyltransferase (AANAT) ELISA Kit

Sign In for Pricing
View Details
Chicken Serotonin N-acetyltransferase (AANAT) ELISA Kit
MBS7238482-02 96 Well

Chicken Serotonin N-acetyltransferase (AANAT) ELISA Kit

Sign In for Pricing
View Details
Chicken Serotonin N-acetyltransferase (AANAT) ELISA Kit
MBS7238482-03 5x 96 Well

Chicken Serotonin N-acetyltransferase (AANAT) ELISA Kit

Sign In for Pricing
View Details
Chicken Serotonin N-acetyltransferase (AANAT) ELISA Kit
MBS7238482-04 10x 96 Well

Chicken Serotonin N-acetyltransferase (AANAT) ELISA Kit

Sign In for Pricing
View Details
Cytokeratin 14 (Keratin Type I Cytoskeletal 14, Cytokeratin-14, CK-14, Keratin-14, K14, KRT14) discontinued
360081-01 50 µL

Cytokeratin 14 (Keratin Type I Cytoskeletal 14, Cytokeratin-14, CK-14, Keratin-14, K14, KRT14) discontinued

Sign In for Pricing
View Details
Cytokeratin 14 (Keratin Type I Cytoskeletal 14, Cytokeratin-14, CK-14, Keratin-14, K14, KRT14) discontinued
360081-02 100 µL

Cytokeratin 14 (Keratin Type I Cytoskeletal 14, Cytokeratin-14, CK-14, Keratin-14, K14, KRT14) discontinued

Sign In for Pricing
View Details