Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPRA1 Rabbit Polyclonal Antibody (HRP)

TPRA1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GPR175, TPRA40, TMEM227

UniProt

Q86W33

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TPRA1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SFFAPLIYVAFLRGFFGSEPKILFSYKCQVDETEEPDVHLPQPYAVARRE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001129525

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal StAR Antibody (STAR/3915R) [DyLight 405]
NBP3-14189V 0.1 mL

Rabbit Monoclonal StAR Antibody (STAR/3915R) [DyLight 405]

Sign In for Pricing
View Details
Lentiviral human GDPD1 sgRNA gene knockout kit - Lentiviral human GDPD1 sgRNA gene knockout kit (plasmid)
GTR15398573 1 Vial

Lentiviral human GDPD1 sgRNA gene knockout kit - Lentiviral human GDPD1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
GTPase Activating Protein Antibody (Phospho-Ser387)
OAAF07604-100UG 100 µg

GTPase Activating Protein Antibody (Phospho-Ser387)

Sign In for Pricing
View Details
PARVB Polyclonal Antibody
ANT-13663-100ug 100 µg

PARVB Polyclonal Antibody

Sign In for Pricing
View Details
FCHSD2 Knockout Raji Polyclonal Cells
ARG1466 1 Million

FCHSD2 Knockout Raji Polyclonal Cells

Sign In for Pricing
View Details
Ki67 Mouse Monoclonal Antibody (HRP)
orb2600775 100 µg

Ki67 Mouse Monoclonal Antibody (HRP)

Sign In for Pricing
View Details