Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C9orf116 Rabbit Polyclonal Antibody (HRP)

C9orf116 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PIERCE1, RbEST47

UniProt

Q5BN46

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C9orf116

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NNPGWFRGYRTQKAVSVYRTSNQAYGSRAPTVHEMPKVFYPNSNKFSQQL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001041730

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HO- (Phpa) -LVA antagonist
065-61 100 µg

HO- (Phpa) -LVA antagonist

Sign In for Pricing
View Details
Rabbit anti-ZNF800 Antibody, Affinity Purified
A303-283A 20 µg

Rabbit anti-ZNF800 Antibody, Affinity Purified

Sign In for Pricing
View Details
AKT3, CT (RAC-gamma Serine/Threonine-protein Kinase, RAC-PK-gamma, Protein Kinase Akt-3, Protein Kinase B, gamma, PKB gamma, STK-2, PKBG) (MaxLight 405)
MBS6462154-01 0.1 mL

AKT3, CT (RAC-gamma Serine/Threonine-protein Kinase, RAC-PK-gamma, Protein Kinase Akt-3, Protein Kinase B, gamma, PKB gamma, STK-2, PKBG) (MaxLight 405)

Sign In for Pricing
View Details
AKT3, CT (RAC-gamma Serine/Threonine-protein Kinase, RAC-PK-gamma, Protein Kinase Akt-3, Protein Kinase B, gamma, PKB gamma, STK-2, PKBG) (MaxLight 405)
MBS6462154-02 5x 0.1 mL

AKT3, CT (RAC-gamma Serine/Threonine-protein Kinase, RAC-PK-gamma, Protein Kinase Akt-3, Protein Kinase B, gamma, PKB gamma, STK-2, PKBG) (MaxLight 405)

Sign In for Pricing
View Details
Human CIN85/SH3KBP1 MAb (Clone 931308)
MAB8877 100 µg

Human CIN85/SH3KBP1 MAb (Clone 931308)

Sign In for Pricing
View Details
Lentiviral mouse F13b shRNA (UAS) - Lentiviral mouse F13b shRNA (UAS, iRFP) (100)
GTR15257991 1 Vial

Lentiviral mouse F13b shRNA (UAS) - Lentiviral mouse F13b shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details