Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CARNMT1 Rabbit Polyclonal Antibody (FITC)

CARNMT1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C9orf41, UPF0586

UniProt

Q8N4J0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human C9orf41

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DGNGKIMPASTFDMDKLKSTLKQFVRDWSETGKAERDACYQPIIKEILKN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689633

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR34, ID (WDR34, WD repeat-containing protein 34) (Azide free) (HRP)
MBS6363207-01 0.2 mL

WDR34, ID (WDR34, WD repeat-containing protein 34) (Azide free) (HRP)

Sign In for Pricing
View Details
WDR34, ID (WDR34, WD repeat-containing protein 34) (Azide free) (HRP)
MBS6363207-02 5x 0.2 mL

WDR34, ID (WDR34, WD repeat-containing protein 34) (Azide free) (HRP)

Sign In for Pricing
View Details
YBOX1, CT (Nuclease-sensitive Element-binding Protein 1, Y-box-binding Protein 1, Y-box Transcription Factor, YB-1, CCAAT-binding, Transcription Factor I Subunit A, CBF-A, Enhancer Factor I Subunit A, EFI-A, DNA-binding Protein B, DBPB, YBX1, NSEP1, YB1) (MaxLight 650) discontinued
Y3050-02-ML650 100 µL

YBOX1, CT (Nuclease-sensitive Element-binding Protein 1, Y-box-binding Protein 1, Y-box Transcription Factor, YB-1, CCAAT-binding, Transcription Factor I Subunit A, CBF-A, Enhancer Factor I Subunit A, EFI-A, DNA-binding Protein B, DBPB, YBX1, NSEP1, YB1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Recombinant Salmonella arizonae Ketol-acid reductoisomerase (ilvC)
MBS1051064-01 0.02 mg (E-Coli)

Recombinant Salmonella arizonae Ketol-acid reductoisomerase (ilvC)

Sign In for Pricing
View Details
Recombinant Salmonella arizonae Ketol-acid reductoisomerase (ilvC)
MBS1051064-02 0.02 mg (Yeast)

Recombinant Salmonella arizonae Ketol-acid reductoisomerase (ilvC)

Sign In for Pricing
View Details
Recombinant Salmonella arizonae Ketol-acid reductoisomerase (ilvC)
MBS1051064-03 0.1 mg (E-Coli)

Recombinant Salmonella arizonae Ketol-acid reductoisomerase (ilvC)

Sign In for Pricing
View Details