Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CARNMT1 Rabbit Polyclonal Antibody (HRP)

CARNMT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C9orf41, UPF0586

UniProt

Q8N4J0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human C9orf41

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DGNGKIMPASTFDMDKLKSTLKQFVRDWSETGKAERDACYQPIIKEILKN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689633

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIST (UHMK1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D3]
TA501719BM 100 µL

KIST (UHMK1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D3]

Sign In for Pricing
View Details
Tissue Protein Lysate, Pancreas
CP625214 150 µg

Tissue Protein Lysate, Pancreas

Sign In for Pricing
View Details
Manual Transfer Stretcher BHBD-815
BHBD-815 1 Unit

Manual Transfer Stretcher BHBD-815

Sign In for Pricing
View Details
Potassium Sodium Tartrate (1.5M Solution in Water)
TRC-P698713-50ML 50 mL

Potassium Sodium Tartrate (1.5M Solution in Water)

Sign In for Pricing
View Details
GPNMB Mouse Monoclonal Antibody [Clone ID: OTI5C2]
CF807728 100 µg

GPNMB Mouse Monoclonal Antibody [Clone ID: OTI5C2]

Sign In for Pricing
View Details
TESC Human Gene Knockout Kit (CRISPR)
KN422650 1 Kit

TESC Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details