Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-7, Human (CHO, hFc)

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (CHO, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by CHO , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Frizzled-7 Protein, Human (CHO, hFc), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-7-protein-human-cho-hfc.html

Purity

95.0

Smiles

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Formula

8324 (Gene_ID) O75084/NP_003498 (Q33-L185) (Accession)

Molecular Weight

46-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CEA Antibody (PARLAM 4) [PE/Cy7]
NBP1-97718PECY7 0.1 mL

Mouse Monoclonal CEA Antibody (PARLAM 4) [PE/Cy7]

Sign In for Pricing
View Details
Mouse Monoclonal Cadherin-6/KCAD Antibody (427909) [CoraFluor 1]
FAB2715CL1 0.1 mL

Mouse Monoclonal Cadherin-6/KCAD Antibody (427909) [CoraFluor 1]

Sign In for Pricing
View Details
FITC Anti-Mouse CD64 Antibody
JOT22038F 20Tests

FITC Anti-Mouse CD64 Antibody

Sign In for Pricing
View Details
Ascc1 antibody
70R-9440 50 ug

Ascc1 antibody

Sign In for Pricing
View Details
MMP-1, human recombinant
7781-50 50 µg

MMP-1, human recombinant

Sign In for Pricing
View Details
Gel Filled Ph Electrode
PHE4090 1 Each

Gel Filled Ph Electrode

Sign In for Pricing
View Details