Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-7, Human (CHO, hFc)

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (CHO, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by CHO , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Frizzled-7 Protein, Human (CHO, hFc), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-7-protein-human-cho-hfc.html

Purity

95.0

Smiles

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Formula

8324 (Gene_ID) O75084/NP_003498 (Q33-L185) (Accession)

Molecular Weight

46-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ONECUT3 3'UTR Luciferase Stable Cell Line
TU016256 1.0 mL

ONECUT3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
BTN1A1 (Butyrophilin Subfamily 1 Member A1, BT, BTN) (MaxLight 490)
124045-ML490 100 µL

BTN1A1 (Butyrophilin Subfamily 1 Member A1, BT, BTN) (MaxLight 490)

Sign In for Pricing
View Details
Phospho-ATF2-T69/T51 Rabbit Polyclonal Antibody
TA332997 100 µg

Phospho-ATF2-T69/T51 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZFY2 Adenovirus (Mouse)
51225054 1.0 mL

ZFY2 Adenovirus (Mouse)

Sign In for Pricing
View Details
Mouse Peptidyl-prolyl cis-trans isomerase FKBP2, FKBP2 ELISA Kit
MBS9340435-01 48 Well

Mouse Peptidyl-prolyl cis-trans isomerase FKBP2, FKBP2 ELISA Kit

Sign In for Pricing
View Details
Mouse Peptidyl-prolyl cis-trans isomerase FKBP2, FKBP2 ELISA Kit
MBS9340435-02 96 Well

Mouse Peptidyl-prolyl cis-trans isomerase FKBP2, FKBP2 ELISA Kit

Sign In for Pricing
View Details