Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-7, Human (CHO, hFc)

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (CHO, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by CHO , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Frizzled-7 Protein, Human (CHO, hFc), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-7-protein-human-cho-hfc.html

Purity

95.0

Smiles

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Formula

8324 (Gene_ID) O75084/NP_003498 (Q33-L185) (Accession)

Molecular Weight

46-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFTN1 ORF Vector (Human) (pORF)
ORF014275 1.0 µg DNA

RFTN1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
GAPDH
316845 100 µL

GAPDH

Sign In for Pricing
View Details
OR51F1 (NM_001004752) Human Tagged ORF Clone Lentiviral Particle
RC222268L3V 200 µL

OR51F1 (NM_001004752) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human anti-hepatitis A virus IgM antibody, anti-HAV ELISA Kit
NB-E10552-01 96 Well

Human anti-hepatitis A virus IgM antibody, anti-HAV ELISA Kit

Sign In for Pricing
View Details
Human anti-hepatitis A virus IgM antibody, anti-HAV ELISA Kit
NB-E10552-02 96 Well

Human anti-hepatitis A virus IgM antibody, anti-HAV ELISA Kit

Sign In for Pricing
View Details
Plexin D1
MBS611287-01 0.1 mg

Plexin D1

Sign In for Pricing
View Details