Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-7, Human (CHO, hFc)

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (CHO, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by CHO , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Frizzled-7 Protein, Human (CHO, hFc), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-7-protein-human-cho-hfc.html

Purity

95.0

Smiles

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Formula

8324 (Gene_ID) O75084/NP_003498 (Q33-L185) (Accession)

Molecular Weight

46-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFIT1 Antibody, HRP conjugated
MBS7048433-01 0.05 mg

IFIT1 Antibody, HRP conjugated

Sign In for Pricing
View Details
IFIT1 Antibody, HRP conjugated
MBS7048433-02 0.1 mg

IFIT1 Antibody, HRP conjugated

Sign In for Pricing
View Details
IFIT1 Antibody, HRP conjugated
MBS7048433-03 5x 0.1 mg

IFIT1 Antibody, HRP conjugated

Sign In for Pricing
View Details
VEZF1, ID (VEZF1, DB1, ZNF161, Vascular endothelial zinc finger 1, Putative transcription factor DB1, Zinc finger protein 161) (Azide free) (HRP) discontinued
043749-HRP 200 µL

VEZF1, ID (VEZF1, DB1, ZNF161, Vascular endothelial zinc finger 1, Putative transcription factor DB1, Zinc finger protein 161) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Anti-CHODL antibody(DMC442), IgG1 Chimeric mAb
TA389542 100 µg

Anti-CHODL antibody(DMC442), IgG1 Chimeric mAb

Sign In for Pricing
View Details
Integrin alpha 6 Recombinant Antibody, Biotin Conjugated
bsm-52265R-Biotin 100 µL

Integrin alpha 6 Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details