Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-7, Human (CHO, hFc)

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (CHO, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by CHO , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Frizzled-7 Protein, Human (CHO, hFc), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-7-protein-human-cho-hfc.html

Purity

95.0

Smiles

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Formula

8324 (Gene_ID) O75084/NP_003498 (Q33-L185) (Accession)

Molecular Weight

46-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

5HT3A receptor (HTR3A) (NM_213621) Human Tagged Lenti ORF Clone
RC221882L4 10 µg

5HT3A receptor (HTR3A) (NM_213621) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SYNGAP1 sgRNA CRISPR Lentivector (Human) (Target 1)
K2320602 1.0 µg DNA

SYNGAP1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Polyclonal Antibody to MBP (myelin basic protein)
35-1808-50 50 μL

Polyclonal Antibody to MBP (myelin basic protein)

Sign In for Pricing
View Details
Chicken Polyclonal Cyclin I Antibody
NB100-75464 0.05 mg

Chicken Polyclonal Cyclin I Antibody

Sign In for Pricing
View Details
Recombinant Human Gastric inhibitory polypeptide/GIP Protein
MBS9148921-01 0.01 mg

Recombinant Human Gastric inhibitory polypeptide/GIP Protein

Sign In for Pricing
View Details
Recombinant Human Gastric inhibitory polypeptide/GIP Protein
MBS9148921-02 0.02 mg

Recombinant Human Gastric inhibitory polypeptide/GIP Protein

Sign In for Pricing
View Details