Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-7, Human (CHO, hFc)

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (CHO, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by CHO , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Frizzled-7 Protein, Human (CHO, hFc), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-7-protein-human-cho-hfc.html

Purity

95.0

Smiles

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Formula

8324 (Gene_ID) O75084/NP_003498 (Q33-L185) (Accession)

Molecular Weight

46-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NME5 (Nucleoside Diphosphate Kinase Homolog 5, NDK-H 5, NDP Kinase Homolog 5, Inhibitor of p53-induced Apoptosis-beta, IPIA-beta, Testis-specific nm23 Homolog, nm23-H5) (HRP)
MBS6153812-01 0.1 mL

NME5 (Nucleoside Diphosphate Kinase Homolog 5, NDK-H 5, NDP Kinase Homolog 5, Inhibitor of p53-induced Apoptosis-beta, IPIA-beta, Testis-specific nm23 Homolog, nm23-H5) (HRP)

Sign In for Pricing
View Details
NME5 (Nucleoside Diphosphate Kinase Homolog 5, NDK-H 5, NDP Kinase Homolog 5, Inhibitor of p53-induced Apoptosis-beta, IPIA-beta, Testis-specific nm23 Homolog, nm23-H5) (HRP)
MBS6153812-02 5x 0.1 mL

NME5 (Nucleoside Diphosphate Kinase Homolog 5, NDK-H 5, NDP Kinase Homolog 5, Inhibitor of p53-induced Apoptosis-beta, IPIA-beta, Testis-specific nm23 Homolog, nm23-H5) (HRP)

Sign In for Pricing
View Details
TBS-PEG5-OH
HY-W552310 1 Each

TBS-PEG5-OH

Sign In for Pricing
View Details
NSBP1 Protein Vector (Human) (pPM-C-HA)
PV028919 500 ng

NSBP1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Monoclonal TTF1 / NKX2.1 Antibody (NX2.1/690) - IHC-Prediluted
NBP2-48104 7 mL

Mouse Monoclonal TTF1 / NKX2.1 Antibody (NX2.1/690) - IHC-Prediluted

Sign In for Pricing
View Details
HOXD9 Mouse Monoclonal Antibody [Clone ID: OTI2B1]
TA809665S 30 µL

HOXD9 Mouse Monoclonal Antibody [Clone ID: OTI2B1]

Sign In for Pricing
View Details