Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-7, Human (CHO, hFc)

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (CHO, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by CHO , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Frizzled-7 Protein, Human (CHO, hFc), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-7-protein-human-cho-hfc.html

Purity

95.0

Smiles

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Formula

8324 (Gene_ID) O75084/NP_003498 (Q33-L185) (Accession)

Molecular Weight

46-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
BNC741820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF594 conjugate, 0.1mg/mL
BNC940012-500 1x 500 µL

Tyrosinase (T311), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (PTH/1175), CF740 conjugate, 0.1mg/mL
BNC741175-100 1x 100 µL

PTH / Parathyroid Hormone (N-Terminal) (PTH/1175), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (DF1513), CF740 conjugate, 0.1mg/mL
BNC740188-500 1x 500 µL

CD71 (DF1513), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF594 conjugate, 0.1mg/mL
BNC941448-100 1x 100 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (IAP/964 + B6H12.2), CF405S conjugate, 0.1mg/mL
BNC041029-100 1x 100 µL

CD47 (IAP/964 + B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details