Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-7, Human (CHO, hFc)

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (CHO, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by CHO , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Frizzled-7 Protein, Human (CHO, hFc), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-7-protein-human-cho-hfc.html

Purity

95.0

Smiles

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Formula

8324 (Gene_ID) O75084/NP_003498 (Q33-L185) (Accession)

Molecular Weight

46-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cmtm5 Mouse shRNA Plasmid (Locus ID 67272)
TL503859 1 Kit

Cmtm5 Mouse shRNA Plasmid (Locus ID 67272)

Sign In for Pricing
View Details
Human PAWR Affinity Purified Polyclonal Ab
AF6885-SP 25 µg

Human PAWR Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
RSPH6A CRISPR Knock Out 293T Cell Line (Human)
42796141 1x 10^6 Cells / 1.0 mL

RSPH6A CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Fish Vasotocin,VT ELISA KIT
JOT-EK0076FI 96 wells

Fish Vasotocin,VT ELISA KIT

Sign In for Pricing
View Details
NOR1 (NR4A3) (NM_006981) Human Over-expression Lysate
LY416280 100 µg

NOR1 (NR4A3) (NM_006981) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse IL-1 alpha Recombinant Rabbit monoclonal Antibody
HA723531B 100 µL

Mouse IL-1 alpha Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details