Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-7, Human (CHO, hFc)

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (CHO, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by CHO , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Frizzled-7 Protein, Human (CHO, hFc), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-7-protein-human-cho-hfc.html

Purity

95.0

Smiles

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Formula

8324 (Gene_ID) O75084/NP_003498 (Q33-L185) (Accession)

Molecular Weight

46-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carcinoembryonic Antigen (CEA, CD66e) BioAssayTM ELISA Kit Not for use in USA, for Export use only discontinued
167549 96 Tests

Carcinoembryonic Antigen (CEA, CD66e) BioAssayTM ELISA Kit Not for use in USA, for Export use only discontinued

Sign In for Pricing
View Details
C6orf57 CRISPR/Cas9 KO Plasmid (h)
sc-410301 20 µg

C6orf57 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
OR1D4/5 Antibody
MBS9509844-01 0.05 mL

OR1D4/5 Antibody

Sign In for Pricing
View Details
OR1D4/5 Antibody
MBS9509844-02 0.1 mL

OR1D4/5 Antibody

Sign In for Pricing
View Details
OR1D4/5 Antibody
MBS9509844-03 5x 0.1 mL

OR1D4/5 Antibody

Sign In for Pricing
View Details
Lentiviral human JAKMIP2 sgRNA gene knockout kit - Lentiviral human JAKMIP2 sgRNA gene knockout kit (100)
GTR15385306 1 Vial

Lentiviral human JAKMIP2 sgRNA gene knockout kit - Lentiviral human JAKMIP2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details