Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-7, Human (CHO, hFc)

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (CHO, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by CHO , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Frizzled-7 Protein, Human (CHO, hFc), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-7-protein-human-cho-hfc.html

Purity

95.0

Smiles

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Formula

8324 (Gene_ID) O75084/NP_003498 (Q33-L185) (Accession)

Molecular Weight

46-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF585A Recombinant Protein (Human)
RP036049 100 µg

ZNF585A Recombinant Protein (Human)

Sign In for Pricing
View Details
Human IDO Alexa Fluor 594 Antibody (Clone 700838)
IC6030T-100UG 100 µg

Human IDO Alexa Fluor 594 Antibody (Clone 700838)

Sign In for Pricing
View Details
N- (4-Ethoxy-phenyl) -2- (3-oxo-1,2,3,4-tetrahydro-quinoxalin-2-yl) -acetamide
sc-279575 1 g

N- (4-Ethoxy-phenyl) -2- (3-oxo-1,2,3,4-tetrahydro-quinoxalin-2-yl) -acetamide

Sign In for Pricing
View Details
TBPL2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
46294151 3x 1.0 µg DNA

TBPL2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
GRIN2B (N-methyl-D-aspartate Receptor 2B, NR2B, NMDAR2B, NR3) discontinued
215317 100 µg

GRIN2B (N-methyl-D-aspartate Receptor 2B, NR2B, NMDAR2B, NR3) discontinued

Sign In for Pricing
View Details
PHYH (NM_006214) Human Recombinant Protein
TP306277L 1 mg

PHYH (NM_006214) Human Recombinant Protein

Sign In for Pricing
View Details