Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-7, Human (CHO, hFc)

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (CHO, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by CHO , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Frizzled-7 Protein, Human (CHO, hFc), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-7-protein-human-cho-hfc.html

Purity

95.0

Smiles

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Formula

8324 (Gene_ID) O75084/NP_003498 (Q33-L185) (Accession)

Molecular Weight

46-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFAP Polyclonal Antibody, PE Conjugated
bs-42001R-PE 100 µL

GFAP Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal Osteoadherin/OSAD/OMD Antibody (107) [Alexa Fluor 405]
NBP2-90596AF405 0.1 mL

Rabbit Monoclonal Osteoadherin/OSAD/OMD Antibody (107) [Alexa Fluor 405]

Sign In for Pricing
View Details
CXXC5 Polyclonal Antibody, HRP Conjugated
bs-6890R-HRP 100 µL

CXXC5 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Recombinant Clostridium Difficile nanE Protein (aa 1-223)
VAng-Lsx9247-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Difficile nanE Protein (aa 1-223)

Sign In for Pricing
View Details
Abcd3 3'UTR GFP Stable Cell Line
TU250069 1.0 mL

Abcd3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
AI450540 (BC062949) Mouse Recombinant Protein
TP508376 20 µg

AI450540 (BC062949) Mouse Recombinant Protein

Sign In for Pricing
View Details