Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-7, Human (CHO, hFc)

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (CHO, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by CHO , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Frizzled-7 Protein, Human (CHO, hFc), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-7-protein-human-cho-hfc.html

Purity

95.0

Smiles

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Formula

8324 (Gene_ID) O75084/NP_003498 (Q33-L185) (Accession)

Molecular Weight

46-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Flvcr1 shRNA (UAS) - Lentiviral mouse Flvcr1 shRNA (UAS, GFP) plasmid
GTR15127678 1 Vial

Lentiviral mouse Flvcr1 shRNA (UAS) - Lentiviral mouse Flvcr1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
SCHIP1 Rabbit Polyclonal Antibody (Center)
E28PB1100 100 µL

SCHIP1 Rabbit Polyclonal Antibody (Center)

Sign In for Pricing
View Details
FBXL14 (NM_152441) Human Over-expression Lysate
LS144699-100ug 100 µg

FBXL14 (NM_152441) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral human SUN5 shRNA (UAS) - Lentiviral human SUN5 shRNA (UAS, GFP) (100)
GTR15106917 1 Vial

Lentiviral human SUN5 shRNA (UAS) - Lentiviral human SUN5 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Feline Coronavirus Matched Antibody Pair Set [ABP-S-05758]
ABP-S-05758 5 Plates

Feline Coronavirus Matched Antibody Pair Set [ABP-S-05758]

Sign In for Pricing
View Details
TEX2 (NM_018469) Human Tagged ORF Clone
RC206901 10 µg

TEX2 (NM_018469) Human Tagged ORF Clone

Sign In for Pricing
View Details