Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-7, Human (CHO, hFc)

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (CHO, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by CHO , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Frizzled-7 Protein, Human (CHO, hFc), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-7-protein-human-cho-hfc.html

Purity

95.0

Smiles

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Formula

8324 (Gene_ID) O75084/NP_003498 (Q33-L185) (Accession)

Molecular Weight

46-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SLC6A8 shRNA (UAS) - Lentiviral human SLC6A8 shRNA (UAS) (25)
GTR15125609 1 Vial

Lentiviral human SLC6A8 shRNA (UAS) - Lentiviral human SLC6A8 shRNA (UAS) (25)

Sign In for Pricing
View Details
Marchf2 Rabbit Polyclonal Antibody
TA356329 100 µL

Marchf2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NDUFA8 Rabbit Polyclonal Antibody
TA351430 100 µL

NDUFA8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Guinea Pig Ciliary Muscle Cells-Immortalized by SV40T Antigens
CC7F993 1x 10^6 Cells/Vial

Guinea Pig Ciliary Muscle Cells-Immortalized by SV40T Antigens

Sign In for Pricing
View Details
Eg5 Inhibitor V, trans-24 100mg
A20019-100 100 mg

Eg5 Inhibitor V, trans-24 100mg

Sign In for Pricing
View Details
STON1-GTF2A1L sgRNA CRISPR Lentivector set (Human)
K2808401 3x 1.0 µg

STON1-GTF2A1L sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details