Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-7, Human (CHO, hFc)

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (CHO, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by CHO , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Frizzled-7 Protein, Human (CHO, hFc), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-7-protein-human-cho-hfc.html

Purity

95.0

Smiles

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Formula

8324 (Gene_ID) O75084/NP_003498 (Q33-L185) (Accession)

Molecular Weight

46-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

REM1 Antibody
A33057-100UG 100 µg

REM1 Antibody

Sign In for Pricing
View Details
Recombinant Borrelia Afzelii rplS Protein (aa 1-119)
VAng-Lsx1598-500gEcoli 500 µg (E. coli)

Recombinant Borrelia Afzelii rplS Protein (aa 1-119)

Sign In for Pricing
View Details
Magi2 3'UTR GFP Stable Cell Line
TU162816 1.0 mL

Magi2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
NIFK (Phospho-Thr234) Antibody
MBS9502869-01 0.05 mL

NIFK (Phospho-Thr234) Antibody

Sign In for Pricing
View Details
NIFK (Phospho-Thr234) Antibody
MBS9502869-02 0.1 mL

NIFK (Phospho-Thr234) Antibody

Sign In for Pricing
View Details
NIFK (Phospho-Thr234) Antibody
MBS9502869-03 5x 0.1 mL

NIFK (Phospho-Thr234) Antibody

Sign In for Pricing
View Details