Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-7, Human (CHO, hFc)

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (CHO, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by CHO , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Frizzled-7 Protein, Human (CHO, hFc), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-7-protein-human-cho-hfc.html

Purity

95.0

Smiles

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Formula

8324 (Gene_ID) O75084/NP_003498 (Q33-L185) (Accession)

Molecular Weight

46-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMARCD1 sgRNA CRISPR Lentivector set (Human)
K2199401 3x 1.0 µg

SMARCD1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal FE65 Antibody [mFluor Violet 610 SE]
NBP2-99557MFV610 0.1 mL

Rabbit Polyclonal FE65 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
CD Markers CD 38
EBS-CD-025 100 μg

CD Markers CD 38

Sign In for Pricing
View Details
Actinomycin D
M14735-01 1 g

Actinomycin D

Sign In for Pricing
View Details
Actinomycin D
M14735-02 200 mg

Actinomycin D

Sign In for Pricing
View Details
Actinomycin D
M14735-03 500 mg

Actinomycin D

Sign In for Pricing
View Details