Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-7, Human (CHO, hFc)

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (CHO, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by CHO , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Frizzled-7 Protein, Human (CHO, hFc), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-7-protein-human-cho-hfc.html

Purity

95.0

Smiles

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Formula

8324 (Gene_ID) O75084/NP_003498 (Q33-L185) (Accession)

Molecular Weight

46-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human High affinity copper uptake protein 1, His-SUMO, Invitro-E.coli-50ug
QP9957-iv-50ug 50ug

Recombinant Human High affinity copper uptake protein 1, His-SUMO, Invitro-E.coli-50ug

Sign In for Pricing
View Details
HCV Core Genotype-1b Biotin
PT-A02376-01 100 µg

HCV Core Genotype-1b Biotin

Sign In for Pricing
View Details
HCV Core Genotype-1b Biotin
PT-A02376-02 500 µg

HCV Core Genotype-1b Biotin

Sign In for Pricing
View Details
HCV Core Genotype-1b Biotin
PT-A02376-03 1000 µg

HCV Core Genotype-1b Biotin

Sign In for Pricing
View Details
PVRL1 antibody
10R-5535 100 ul

PVRL1 antibody

Sign In for Pricing
View Details
MS4A12 (Membrane-spanning 4-domains Subfamily A Member 12, FLJ20217, Ms4a10) (HRP)
MBS6153601-01 0.1 mL

MS4A12 (Membrane-spanning 4-domains Subfamily A Member 12, FLJ20217, Ms4a10) (HRP)

Sign In for Pricing
View Details