Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-7, Human (CHO, hFc)

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (CHO, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by CHO , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Frizzled-7 Protein, Human (CHO, hFc), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-7-protein-human-cho-hfc.html

Purity

95.0

Smiles

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Formula

8324 (Gene_ID) O75084/NP_003498 (Q33-L185) (Accession)

Molecular Weight

46-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2464205 3x 1.0 µg

TRIM15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
GYG1 (Glycogenin 1, Glycogenin-1, GN-1, GN1, GYG) (MaxLight 550)
127683-ML550 100 µL

GYG1 (Glycogenin 1, Glycogenin-1, GN-1, GN1, GYG) (MaxLight 550)

Sign In for Pricing
View Details
OR4N2 (NM_001004723) Human Untagged Clone
SC300761 10 µg

OR4N2 (NM_001004723) Human Untagged Clone

Sign In for Pricing
View Details
Olfr1200 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4254402 1.0 µg DNA

Olfr1200 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Spark Blue™ 515 Armenian Hamster IgG Isotype Ctrl
GT17346 25 µg

Spark Blue™ 515 Armenian Hamster IgG Isotype Ctrl

Sign In for Pricing
View Details
TGIF2 (TGFB-Induced Factor Homeobox 2)
252599 100 µg

TGIF2 (TGFB-Induced Factor Homeobox 2)

Sign In for Pricing
View Details