Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-7, Human (CHO, hFc)

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (CHO, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by CHO , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Frizzled-7 Protein, Human (CHO, hFc), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-7-protein-human-cho-hfc.html

Purity

95.0

Smiles

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Formula

8324 (Gene_ID) O75084/NP_003498 (Q33-L185) (Accession)

Molecular Weight

46-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CYP26B1 antibody
STJ114035 100 µl

Anti-CYP26B1 antibody

Sign In for Pricing
View Details
2.0 mL self-standing screw cap microcentrifuge tube, graduated, natural with yellow cap, 500/pack
1420-9706 500/PCK

2.0 mL self-standing screw cap microcentrifuge tube, graduated, natural with yellow cap, 500/pack

Sign In for Pricing
View Details
VN1R10P AAV Vector (Human) (CMV)
49860101 1 µg

VN1R10P AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Maackia amurensis Lectin (MAA/MAL II) -Biotinylated
HY-N12931F 1 mg

Maackia amurensis Lectin (MAA/MAL II) -Biotinylated

Sign In for Pricing
View Details
Rat Miip Pre-designed siRNA Set A
SI208445A 1 Each

Rat Miip Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Monoclonal Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (027) [Alexa Fluor 488]
NBP2-89871AF488 0.1 mL

Rabbit Monoclonal Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (027) [Alexa Fluor 488]

Sign In for Pricing
View Details