Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-7, Human (CHO, hFc)

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (CHO, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by CHO , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Frizzled-7 Protein, Human (CHO, hFc), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-7-protein-human-cho-hfc.html

Purity

95.0

Smiles

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Formula

8324 (Gene_ID) O75084/NP_003498 (Q33-L185) (Accession)

Molecular Weight

46-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gamma Glutamyl Transferase (F)
MA-0284 100 Well

Gamma Glutamyl Transferase (F)

Sign In for Pricing
View Details
P53, phosphorylated (Ser20) (Cellular Tumor Antigen p53, Tumor Suppressor p53, Phosphoprotein p53, Antigen NY-CO-13, TP53, P53) (MaxLight 405) discontinued
P1001-27K1-ML405 100 µL

P53, phosphorylated (Ser20) (Cellular Tumor Antigen p53, Tumor Suppressor p53, Phosphoprotein p53, Antigen NY-CO-13, TP53, P53) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Aggrecan Antibody, C-terminal neoepitope NITEGE
1042003 100 µg

Aggrecan Antibody, C-terminal neoepitope NITEGE

Sign In for Pricing
View Details
Frozen Tissue Sections, Cervix
CS503117 5x 5 µm

Frozen Tissue Sections, Cervix

Sign In for Pricing
View Details
NDUB3 Rabbit Polyclonal Antibody
MBS9515681-01 0.05 mL

NDUB3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NDUB3 Rabbit Polyclonal Antibody
MBS9515681-02 0.1 mL

NDUB3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details