Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC74A Rabbit Polyclonal Antibody (HRP)

LRRC74A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LRRC74, C14orf166B

UniProt

Q0VAA2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C14orf166B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GMPPDEIEIEPVRQSSDKMLYCEAESPPTVEKVKPARENSETDLEIEDDE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human

Tested Applications

WB

NCBI Accession Number

NP_919263

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WWP1 Antibody
A38516-100UL 100 µL

WWP1 Antibody

Sign In for Pricing
View Details
MLNR 3'UTR GFP Stable Cell Line
TU064363 1.0 mL

MLNR 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Structural Maintenance Of Chromosomes 1A (SMC1A) Antibody
abx159694 100 µL

Structural Maintenance Of Chromosomes 1A (SMC1A) Antibody

Sign In for Pricing
View Details
Anti-TMC7 Antibody
A14820 100 µL

Anti-TMC7 Antibody

Sign In for Pricing
View Details
ZNF518A sgRNA CRISPR Lentivector (Human) (Target 1)
K2711602 1.0 µg DNA

ZNF518A sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Beta I Tubulin Monoclonal Antibody, AbBy Fluor™ 647 Conjugated
bsm-33125M-BF647 100 µL

Beta I Tubulin Monoclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details