Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEKT5 Rabbit Polyclonal Antibody (FITC)

TEKT5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CT149

UniProt

Q96M29

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TEKT5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QVRGAEASRLWASRLTDDSMRLLQDKDQLTHQMQEGTCRNLGQRLSDIGF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_653275

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2 Protein Vector (Human) (pPM-C-His)
PV066328 500 ng

C2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
LRRFIP1 (Leucine-rich Repeat Flightless-interacting Protein 1, LRR FLII-interacting Protein 1, GC-binding Factor 2, TAR RNA-interacting Protein, GCF2, TRIP) (Biotin)
MBS6142755-01 0.1 mL

LRRFIP1 (Leucine-rich Repeat Flightless-interacting Protein 1, LRR FLII-interacting Protein 1, GC-binding Factor 2, TAR RNA-interacting Protein, GCF2, TRIP) (Biotin)

Sign In for Pricing
View Details
LRRFIP1 (Leucine-rich Repeat Flightless-interacting Protein 1, LRR FLII-interacting Protein 1, GC-binding Factor 2, TAR RNA-interacting Protein, GCF2, TRIP) (Biotin)
MBS6142755-02 5x 0.1 mL

LRRFIP1 (Leucine-rich Repeat Flightless-interacting Protein 1, LRR FLII-interacting Protein 1, GC-binding Factor 2, TAR RNA-interacting Protein, GCF2, TRIP) (Biotin)

Sign In for Pricing
View Details
Lentiviral mouse Atg9b shRNA (UAS) - Lentiviral mouse Atg9b shRNA (UAS, RFP) (100)
GTR15180780 1 Vial

Lentiviral mouse Atg9b shRNA (UAS) - Lentiviral mouse Atg9b shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
2-{[ (tert-Butoxy) carbonyl]amino}-2-cyclobutylpropanoic acid
DAD77428-01 50 mg

2-{[ (tert-Butoxy) carbonyl]amino}-2-cyclobutylpropanoic acid

Sign In for Pricing
View Details
2-{[ (tert-Butoxy) carbonyl]amino}-2-cyclobutylpropanoic acid
DAD77428-02 0.5 g

2-{[ (tert-Butoxy) carbonyl]amino}-2-cyclobutylpropanoic acid

Sign In for Pricing
View Details