Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF151 Rabbit Polyclonal Antibody (HRP)

RNF151 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q2KHN1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human RNF151

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AHRKGHQDSCPFELTACPNEGCTSQVPRGTLAEHRQHCQQGSQQRCPLGC

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_777563

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MED4 Protein, His, E.coli-5ug
QP12673-5ug 5ug

Recombinant Human MED4 Protein, His, E.coli-5ug

Sign In for Pricing
View Details
PET112 Antibody
orb846432 2 mg

PET112 Antibody

Sign In for Pricing
View Details
Zfp446 AAV Vector (Mouse) (CMV)
50979105 1 µg

Zfp446 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Rat E1A Binding Protein P300 (EP300) CLIA Kit
abx493550-01 96 Tests

Rat E1A Binding Protein P300 (EP300) CLIA Kit

Sign In for Pricing
View Details
Rat E1A Binding Protein P300 (EP300) CLIA Kit
abx493550-02 5x 96 Tests

Rat E1A Binding Protein P300 (EP300) CLIA Kit

Sign In for Pricing
View Details
Rat E1A Binding Protein P300 (EP300) CLIA Kit
abx493550-03 10x 96 Tests

Rat E1A Binding Protein P300 (EP300) CLIA Kit

Sign In for Pricing
View Details