Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC155 Rabbit Polyclonal Antibody (HRP)

CCDC155 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CCDC155

UniProt

Q8N6L0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC155

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VIHETSEETEFPSEAPAGGQRNFQGEPAHPEEGRKEPSMWLTRREEEEDA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

NCBI Accession Number

NP_653289

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUP43 (Nucleoporin Nup43, Nup107-160 Subcomplex Subunit Nup43, p42, FLJ13287, bA350J20.1, p42) (MaxLight 750)
MBS6234249-01 0.1 mL

NUP43 (Nucleoporin Nup43, Nup107-160 Subcomplex Subunit Nup43, p42, FLJ13287, bA350J20.1, p42) (MaxLight 750)

Sign In for Pricing
View Details
NUP43 (Nucleoporin Nup43, Nup107-160 Subcomplex Subunit Nup43, p42, FLJ13287, bA350J20.1, p42) (MaxLight 750)
MBS6234249-02 5x 0.1 mL

NUP43 (Nucleoporin Nup43, Nup107-160 Subcomplex Subunit Nup43, p42, FLJ13287, bA350J20.1, p42) (MaxLight 750)

Sign In for Pricing
View Details
FLT3, NT (Tyrosine-protein Kinase Receptor FLT3, Fms-like Tyrosine Kinase 3, FLT-3, STK1, FL Cytokine Receptor, Stem Cell Tyrosine Kinase 1, STK-1, CD135) (MaxLight 650)
MBS6476648-01 0.1 mL

FLT3, NT (Tyrosine-protein Kinase Receptor FLT3, Fms-like Tyrosine Kinase 3, FLT-3, STK1, FL Cytokine Receptor, Stem Cell Tyrosine Kinase 1, STK-1, CD135) (MaxLight 650)

Sign In for Pricing
View Details
FLT3, NT (Tyrosine-protein Kinase Receptor FLT3, Fms-like Tyrosine Kinase 3, FLT-3, STK1, FL Cytokine Receptor, Stem Cell Tyrosine Kinase 1, STK-1, CD135) (MaxLight 650)
MBS6476648-02 5x 0.1 mL

FLT3, NT (Tyrosine-protein Kinase Receptor FLT3, Fms-like Tyrosine Kinase 3, FLT-3, STK1, FL Cytokine Receptor, Stem Cell Tyrosine Kinase 1, STK-1, CD135) (MaxLight 650)

Sign In for Pricing
View Details
COPS3 Rabbit Polyclonal Antibody (PE)
orb491282 100 µL

COPS3 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
MT3 (Metallothionein 3, GIF, GIFB, GRIF) (HRP)
248982-HRP 100 µL

MT3 (Metallothionein 3, GIF, GIFB, GRIF) (HRP)

Sign In for Pricing
View Details