Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD19 Rabbit Polyclonal Antibody (HRP)

BTBD19 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

C9JJ37

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human BTBD19

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LERPVAEVAAPVVKELRLALLAPAELSALEEQNRQEPLIPVEQIVEAWKC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001130009

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTFE hydrophilic 13mm*0.22μm syringe filter
ZL-PTFE-Q13-22 100 PCS/Box

PTFE hydrophilic 13mm*0.22μm syringe filter

Sign In for Pricing
View Details
B4GALT7 Antibody, HRP conjugated
CSB-PA890666LB01HU-01 50 µg

B4GALT7 Antibody, HRP conjugated

Sign In for Pricing
View Details
B4GALT7 Antibody, HRP conjugated
CSB-PA890666LB01HU-02 100 µg

B4GALT7 Antibody, HRP conjugated

Sign In for Pricing
View Details
CD45RA Antibody
V4776-100UG 100 µg

CD45RA Antibody

Sign In for Pricing
View Details
BRCAA1 (Breast Cancer-Associated Antigen 1, BRCAA-1, Retinoblastoma-binding Protein 1-like 1, BRCAA 1) (APC)
MBS6452027-01 0.1 mL

BRCAA1 (Breast Cancer-Associated Antigen 1, BRCAA-1, Retinoblastoma-binding Protein 1-like 1, BRCAA 1) (APC)

Sign In for Pricing
View Details
BRCAA1 (Breast Cancer-Associated Antigen 1, BRCAA-1, Retinoblastoma-binding Protein 1-like 1, BRCAA 1) (APC)
MBS6452027-02 5x 0.1 mL

BRCAA1 (Breast Cancer-Associated Antigen 1, BRCAA-1, Retinoblastoma-binding Protein 1-like 1, BRCAA 1) (APC)

Sign In for Pricing
View Details