Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YDJC Rabbit Polyclonal Antibody (HRP)

YDJC Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A8MPS7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human YDJC

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SAHRVSGALARVLEGTLAGHTLTAELMAHPGYPSVPPTGGCGEGPDAFSC

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001017964

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR1 Recombinant Rabbit Monoclonal Antibody [JE64-32]
HA721053 100 µL

WDR1 Recombinant Rabbit Monoclonal Antibody [JE64-32]

Sign In for Pricing
View Details
GM CSF Receptor alpha (CSF2RA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B2]
TA812521BM 100 µL

GM CSF Receptor alpha (CSF2RA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B2]

Sign In for Pricing
View Details
CD63 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D12]
TA803392BM 100 µL

CD63 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D12]

Sign In for Pricing
View Details
SERPINB8 (NM_001031848) Human Over-expression Lysate
LC422205 20 µg

SERPINB8 (NM_001031848) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Gastroesophageal junction
CR559245 5 µg

Tissue Total RNA, Gastroesophageal junction

Sign In for Pricing
View Details
IL17RA antibody
FNab09773 100 µg

IL17RA antibody

Sign In for Pricing
View Details