Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PQLC2L Rabbit Polyclonal Antibody (HRP)

PQLC2L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PQLC2L, C3orf55, SLC66A2L

UniProt

A1A4F0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C3orf55

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KVVGNYRVNTANSSTDTSGEHLTCLRSQLFVAYRNGRVDEAVSLGFLDCW

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001093247

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VDAC3 (Voltage-dependent Anion-selective Channel Protein 3, VDAC-3, hVDAC3, Outer Mitochondrial Membrane Protein Porin 3) (FITC)
135228-FITC 100 µL

VDAC3 (Voltage-dependent Anion-selective Channel Protein 3, VDAC-3, hVDAC3, Outer Mitochondrial Membrane Protein Porin 3) (FITC)

Sign In for Pricing
View Details
GATAD2A, NT (GATAD2A, Transcriptional repressor p66-alpha, GATA zinc finger domain-containing protein 2A) (PE)
MBS6301356-01 0.2 mL

GATAD2A, NT (GATAD2A, Transcriptional repressor p66-alpha, GATA zinc finger domain-containing protein 2A) (PE)

Sign In for Pricing
View Details
GATAD2A, NT (GATAD2A, Transcriptional repressor p66-alpha, GATA zinc finger domain-containing protein 2A) (PE)
MBS6301356-02 5x 0.2 mL

GATAD2A, NT (GATAD2A, Transcriptional repressor p66-alpha, GATA zinc finger domain-containing protein 2A) (PE)

Sign In for Pricing
View Details
PSAP Protein Vector (Rat) (pPM-C-His)
PV296705 500 ng

PSAP Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Indobufen Impurity 4
RM-I041530-01 10 mg

Indobufen Impurity 4

Sign In for Pricing
View Details
Indobufen Impurity 4
RM-I041530-02 25 mg

Indobufen Impurity 4

Sign In for Pricing
View Details