Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ODAPH Rabbit Polyclonal Antibody (HRP)

ODAPH Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI2A4, C4orf26

UniProt

Q17RF5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C4orf26

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MARRHCFSYWLLVCWLVVTVAEGQEEVFTPPGDSQNNADATDCQIFTLTP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_848592

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor Xa, Gla-domainless, Human
F0018-30 100 µg

Factor Xa, Gla-domainless, Human

Sign In for Pricing
View Details
Ankyrin G Rabbit Polyclonal Antibody (BF555)
orb1602845 100 µL

Ankyrin G Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
NR1D1 (Nuclear Receptor Subfamily 1 Group D Member 1, Rev-erbA-alpha, V-erbA-related Protein 1, EAR-1, EAR1, HREV, THRAL) (PE)
130528-PE 100 µL

NR1D1 (Nuclear Receptor Subfamily 1 Group D Member 1, Rev-erbA-alpha, V-erbA-related Protein 1, EAR-1, EAR1, HREV, THRAL) (PE)

Sign In for Pricing
View Details
Recombinant Salmonella gallinarum Nitric oxide reductase FlRd-NAD (+) reductase
MBS1002362-01 0.02 mg (E-Coli)

Recombinant Salmonella gallinarum Nitric oxide reductase FlRd-NAD (+) reductase

Sign In for Pricing
View Details
Recombinant Salmonella gallinarum Nitric oxide reductase FlRd-NAD (+) reductase
MBS1002362-02 0.02 mg (Yeast)

Recombinant Salmonella gallinarum Nitric oxide reductase FlRd-NAD (+) reductase

Sign In for Pricing
View Details
Recombinant Salmonella gallinarum Nitric oxide reductase FlRd-NAD (+) reductase
MBS1002362-03 0.1 mg (E-Coli)

Recombinant Salmonella gallinarum Nitric oxide reductase FlRd-NAD (+) reductase

Sign In for Pricing
View Details