Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP54 Rabbit Polyclonal Antibody (Biotin)

USP54 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C10orf29, bA137L10.3, bA137L10.4

UniProt

Q70EL1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human USP54

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TPGPRRVDMPPDDDWRQSSYASHSGHRRTVGEGFLFVLSDAPRREQIRAR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

168kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prednisolone 21-Dimethylamine-d6
462939 1 mg

Prednisolone 21-Dimethylamine-d6

Sign In for Pricing
View Details
Chicken Ras Related Protein Rab 8A (RAB8A) ELISA Kit
MBS7265533-01 48 Well

Chicken Ras Related Protein Rab 8A (RAB8A) ELISA Kit

Sign In for Pricing
View Details
Chicken Ras Related Protein Rab 8A (RAB8A) ELISA Kit
MBS7265533-02 96 Well

Chicken Ras Related Protein Rab 8A (RAB8A) ELISA Kit

Sign In for Pricing
View Details
Chicken Ras Related Protein Rab 8A (RAB8A) ELISA Kit
MBS7265533-03 5x 96 Well

Chicken Ras Related Protein Rab 8A (RAB8A) ELISA Kit

Sign In for Pricing
View Details
Chicken Ras Related Protein Rab 8A (RAB8A) ELISA Kit
MBS7265533-04 10x 96 Well

Chicken Ras Related Protein Rab 8A (RAB8A) ELISA Kit

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Ras-related protein rapC (rapC)
MBS1407155-01 0.02 mg (E-Coli)

Recombinant Dictyostelium discoideum Ras-related protein rapC (rapC)

Sign In for Pricing
View Details