Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP54 Rabbit Polyclonal Antibody (HRP)

USP54 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C10orf29, bA137L10.3, bA137L10.4

UniProt

Q70EL1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human USP54

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TPGPRRVDMPPDDDWRQSSYASHSGHRRTVGEGFLFVLSDAPRREQIRAR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

168kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Formylbenzenesulfonic Acid
TRC-F754725-1G 1 g

4-Formylbenzenesulfonic Acid

Sign In for Pricing
View Details
LOC728392 (NM_001162371) Human Over-expression Lysate
LC431086 20 µg

LOC728392 (NM_001162371) Human Over-expression Lysate

Sign In for Pricing
View Details
LTA4H Recombinant Rabbit Monoclonal Antibody [JE52-14]
ET7110-13 100 µL

LTA4H Recombinant Rabbit Monoclonal Antibody [JE52-14]

Sign In for Pricing
View Details
Tissue FFPE Sections, Rectum
CS804864 5x 5 µm

Tissue FFPE Sections, Rectum

Sign In for Pricing
View Details
Human OR5H6 activation kit by CRISPRa
GA112421 1 Kit

Human OR5H6 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS708762 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details