Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OIT3 Rabbit Polyclonal Antibody (FITC)

OIT3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LZP

UniProt

Q8WWZ8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OIT3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CRVLVCGVLDERSRCAQGCHRRMRRGAGGEDSAGLQGQTLTGGPIRIDWE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_689848

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 (Vascular Cell Adhesion Protein 1, V-CAM 1, VCAM-1, INCAM-100, VCAM1, L1CAM) discontinued. See 030716
C2446-74J 50 µL

CD106 (Vascular Cell Adhesion Protein 1, V-CAM 1, VCAM-1, INCAM-100, VCAM1, L1CAM) discontinued. See 030716

Sign In for Pricing
View Details
Phospho-CDK6 (Tyr13) Rabbit Polyclonal Antibody (FITC)
orb7723 100 µL

Phospho-CDK6 (Tyr13) Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Fe/S Biogenesis Protein NfuA, Recombinant, E. coli, aa1-191, MBP-Tag, His-Avi-Tag, Biotinylated
584514-01 20 µg

Fe/S Biogenesis Protein NfuA, Recombinant, E. coli, aa1-191, MBP-Tag, His-Avi-Tag, Biotinylated

Sign In for Pricing
View Details
Fe/S Biogenesis Protein NfuA, Recombinant, E. coli, aa1-191, MBP-Tag, His-Avi-Tag, Biotinylated
584514-02 100 µg

Fe/S Biogenesis Protein NfuA, Recombinant, E. coli, aa1-191, MBP-Tag, His-Avi-Tag, Biotinylated

Sign In for Pricing
View Details
GAL 1 (Galectin 1, LGALS1, GBP, HLBP14, Galaptin, Lectin, Galactoside-Binding Soluble 1, 14kD laminin-binding protein, Lactose-binding lectin 1, Putative MAPK-activating protein PM12, S-Lac lectin)
363197 200 µL

GAL 1 (Galectin 1, LGALS1, GBP, HLBP14, Galaptin, Lectin, Galactoside-Binding Soluble 1, 14kD laminin-binding protein, Lactose-binding lectin 1, Putative MAPK-activating protein PM12, S-Lac lectin)

Sign In for Pricing
View Details
UPB1 Protein Vector (Rat) (pPB-C-His)
PV314562 500 ng

UPB1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details