Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC107 Rabbit Polyclonal Antibody (Biotin)

CCDC107 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PSEC0222

UniProt

Q8WV48

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CCDC107

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PPLKDQRERTRAGSLPLGALYTAAVAAFVLYKCLQGKDETAVLHEEASKQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_777583

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Shc2 (NM_001024539) Mouse Tagged Lenti ORF Clone
MR215808L4 10 µg

Shc2 (NM_001024539) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Porcine 14 3 3 protein eta (YWHAH) ELISA kit
GTR10387485 96 Well

Porcine 14 3 3 protein eta (YWHAH) ELISA kit

Sign In for Pricing
View Details
Cy3 Linked Polyclonal Antibody to TCell Surface Glycoprotein CD3 Epsilon (CD3e)
MBS2135933-01 0.1 mL

Cy3 Linked Polyclonal Antibody to TCell Surface Glycoprotein CD3 Epsilon (CD3e)

Sign In for Pricing
View Details
Cy3 Linked Polyclonal Antibody to TCell Surface Glycoprotein CD3 Epsilon (CD3e)
MBS2135933-02 0.2 mL

Cy3 Linked Polyclonal Antibody to TCell Surface Glycoprotein CD3 Epsilon (CD3e)

Sign In for Pricing
View Details
Cy3 Linked Polyclonal Antibody to TCell Surface Glycoprotein CD3 Epsilon (CD3e)
MBS2135933-03 0.5 mL

Cy3 Linked Polyclonal Antibody to TCell Surface Glycoprotein CD3 Epsilon (CD3e)

Sign In for Pricing
View Details
Cy3 Linked Polyclonal Antibody to TCell Surface Glycoprotein CD3 Epsilon (CD3e)
MBS2135933-04 1 mL

Cy3 Linked Polyclonal Antibody to TCell Surface Glycoprotein CD3 Epsilon (CD3e)

Sign In for Pricing
View Details