Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C6ORF163 Rabbit Polyclonal Antibody (HRP)

C6ORF163 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

E1P506

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human C6ORF163

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FLEEELQETRMAFQKYINYTFPKLSPGHADFILPERKKTPSNLVIKENKT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

XP_005248730.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), CF488A conjugate, 0.1mg/mL
BNC882600-500 1x 500 µL

EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CSPP1 (NM_001291339) Human Tagged ORF Clone
RG239722 10 µg

CSPP1 (NM_001291339) Human Tagged ORF Clone

Sign In for Pricing
View Details
SHQ1 (N-term) Rabbit Polyclonal Antibody
AP53912PU-N 400 µL

SHQ1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1700052K11Rik (BC099431) Mouse Tagged ORF Clone
MG200418 10 µg

1700052K11Rik (BC099431) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Adiponectin (ADIPOQ) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E7]
TA804645BM 100 µL

Adiponectin (ADIPOQ) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E7]

Sign In for Pricing
View Details
RAB3IP Mouse Monoclonal Antibody [Clone ID: OTI5F2]
CF808960 100 µg

RAB3IP Mouse Monoclonal Antibody [Clone ID: OTI5F2]

Sign In for Pricing
View Details