Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4S2 Rabbit Polyclonal Antibody (Biotin)

OR4S2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OR4S2P, OST725, OR11-137

UniProt

Q8NH73

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR4S2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VVTANSGTIALGSFVILLISYSIILVSLRKQSAEGRRKALSTCGSHIAMV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004059

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC27A4 Rabbit Polyclonal Antibody (BF350)
orb1608310 100 µL

SLC27A4 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
FSH beta Polyclonal Antibody Bio Conjugated
MBS9462922-01 0.1 mL

FSH beta Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
FSH beta Polyclonal Antibody Bio Conjugated
MBS9462922-02 5x 0.1 mL

FSH beta Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Avl9 shRNA (UAS) - Lentiviral mouse Avl9 shRNA (UAS, iRFP) (25)
GTR15225710 1 Vial

Lentiviral mouse Avl9 shRNA (UAS) - Lentiviral mouse Avl9 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Recombinant Human Cytochrome b reductase 1 (CYBRD1)
orb2910903-01 20 µg

Recombinant Human Cytochrome b reductase 1 (CYBRD1)

Sign In for Pricing
View Details
Recombinant Human Cytochrome b reductase 1 (CYBRD1)
orb2910903-02 100 µg

Recombinant Human Cytochrome b reductase 1 (CYBRD1)

Sign In for Pricing
View Details